Structure of PDB 1d7q Chain A |
>1d7qA (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] |
PKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMC FDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEAR SLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI |
|
PDB | 1d7q The eIF1A solution structure reveals a large RNA-binding surface important for scanning function. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
P15 K16 |
P1 K2 |
|
|
|
|