Structure of PDB 1cyd Chain A

Receptor sequence

>1cydA (length=242) Species: 10090 (Mus musculus)

LNFSGLRALVTGAGKGIGRDTVKALHASGAKVVAVTRTNSDLVSLAKECP
GIEPVCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDR
SFSVNLRSVFQVSQMVARDMINRGVPGSIVNVSSMVAHVTFPNLITYSST
KGAMTMLTKAMAMELGPHKIRVNSVNPTVVLTDMGKKVSADPEFARKLKE
RHPLRKFAEVEDVVNSILFLLSDRSASTSGGGILVDAGYLAS

3D structure

• PDB: 1cyd Crystal structure of the ternary complex of mouse lung carbonyl reductase at 1.8 A resolution: the structural origin of coenzyme specificity in the short-chain dehydrogenase/reductase family.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G18 S136 L146 Y149 K153
• Catalytic site (residue number reindexed from 1): G16 S134 L144 Y147 K151
• Enzyme Commision number: 1.1.1.184: carbonyl reductase (NADPH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	A	G14 G16 K17 I19 R39 T40 D60 L61 N83 A85 V106 V134 S136 Y149 K153 P179 T180 V181 V182 T184 M186 G187	G12 G14 K15 I17 R37 T38 D58 L59 N81 A83 V104 V132 S134 Y147 K151 P177 T178 V179 V180 T182 M184 G185
BS02	IPA	A	S136 Y149 V190	S134 Y147 V188

Gene Ontology

Molecular Function

• GO:0004090 carbonyl reductase (NADPH) activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006116 NADH oxidation
• GO:0044281 small molecule metabolic process

Cellular Component

• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix

External links

• PDB: RCSB:1cyd, PDBe:1cyd, PDBj:1cyd
• PDBsum: 1cyd
• PubMed: 8805511
• UniProt: P08074|CBR2_MOUSE Carbonyl reductase [NADPH] 2 (Gene Name=Cbr2)