Structure of PDB 1cyc Chain A

Receptor sequence
>1cycA (length=103) Species: 8226 (Katsuwonus pelamis) [Search protein sequence]
GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTD
ANKSKGIVWNENTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKS
ATS
3D structure
PDB1cyc The crystal structure of bonito (katsuo) ferrocytochrome c at 2.3 A resolution. II. Structure and function.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC A K13 C14 C17 H18 L32 R38 Y46 Y48 N52 T78 K79 M80 F82 K13 C14 C17 H18 L32 R38 Y46 Y48 N52 T78 K79 M80 F82
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
GO:0043280 positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
Cellular Component
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1cyc, PDBe:1cyc, PDBj:1cyc
PDBsum1cyc
PubMed166072
UniProtP00025|CYC_KATPE Cytochrome c (Gene Name=cyc)

[Back to BioLiP]