Structure of PDB 1cxy Chain A

Receptor sequence
>1cxyA (length=81) Species: 1054 (Ectothiorhodospira shaposhnikovii) [Search protein sequence]
TLPVFTLEQVAEHHSPDDCWMAIHGKVYDLTPYVPNHPGPAGMMLVWCGQ
ESTEAWETKSYGEPHSSLAARLLQRYLIGTL
3D structure
PDB1cxy Structure and characterization of Ectothiorhodospira vacuolata cytochrome b(558), a prokaryotic homologue of cytochrome b(5).
ChainA
Resolution1.65 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H42 Y66
Catalytic site (residue number reindexed from 1) H37 Y61
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A L35 Y38 H42 P43 M49 W61 K64 Y66 H70 S71 A74 L78 L30 Y33 H37 P38 M44 W56 K59 Y61 H65 S66 A69 L73
Gene Ontology
Molecular Function
GO:0020037 heme binding
GO:0046872 metal ion binding
Cellular Component
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1cxy, PDBe:1cxy, PDBj:1cxy
PDBsum1cxy
PubMed10585439
UniProtP82291|CYB5_ECTSH Soluble cytochrome b558

[Back to BioLiP]