Structure of PDB 1cxv Chain A

Receptor sequence

>1cxvA (length=160) Species: 10090 (Mus musculus) [Search protein sequence]

YNVFPRTLKWSQTNLTYRIVNYTPDMSHSEVEKAFRKAFKVWSDVTPLNF
TRIYDGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDD
DETWTSSSKGYNLFIVAAHELGHSLGLDHSKDPGALMFPIYTYTFMLPDD
DVQGIQFLYG

3D structure

PDB

1cxv Structure of recombinant mouse collagenase-3 (MMP-13).

Chain

Resolution

2.0 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H201 E202 H205 H211
Catalytic site (residue number reindexed from 1)	H119 E120 H123 H129
Enzyme Commision number	3.4.24.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ZN	A	H201 H205 H211	H119 H123 H129
BS02	ZN	A	H151 D153 H166 H179	H69 D71 H84 H97
BS03	CA	A	W92 D141 G171 G175	W10 D59 G89 G93
BS04	CA	A	D158 G159 S161 L163 D181 E184	D76 G77 S79 L81 D99 E102
BS05	CBP	A	Y155 L163 L164 A165 I197 H201 E202 H205 H211 L218 F220 I222 Y223 T224	Y73 L81 L82 A83 I115 H119 E120 H123 H129 L136 F138 I140 Y141 T142

Gene Ontology

	Molecular Function
GO:0004222	metalloendopeptidase activity
GO:0008237	metallopeptidase activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0031012	extracellular matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1cxv, PDBe:1cxv, PDBj:1cxv
PDBsum	1cxv
PubMed	10525409
UniProt	P33435\|MMP13_MOUSE Collagenase 3 (Gene Name=Mmp13)

[Back to BioLiP]