Structure of PDB 1cxc Chain A

Receptor sequence

>1cxcA (length=124) Species: 1063 (Cereibacter sphaeroides)

QEGDPEAGAKAFNQCQTCHVIVDDSGTTIAGRNAKTGPNLYGVVGRTAGT
QADFKGYGEGMKEAGAKGLAWDEEHFVQYVQDPTKFLKEYTGDAKAKGKM
TFKLKKEADAHNIWAYLQQVAVRP

3D structure

• PDB: 1cxc Crystallization and X-ray structure determination of cytochrome c2 from Rhodobacter sphaeroides in three crystal forms.
• Chain: A
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C15 C18 H19 G37 P38 Y57 M61 W71 Y79 G98 K99 M100 F102	C15 C18 H19 G37 P38 Y57 M61 W71 Y79 G98 K99 M100 F102

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1cxc, PDBe:1cxc, PDBj:1cxc
• PDBsum: 1cxc
• PubMed: 15299423
• UniProt: P0C0X8|CYC2_CERSP Cytochrome c2 (Gene Name=cycA)