Structure of PDB 1cwu Chain A

Receptor sequence

>1cwuA (length=296) Species: 3708 (Brassica napus)

LPIDLRGKRAFIAGIADDNGYGWAVAKSLAAAGAEILVGTWVPALNIFET
SLRRGKFDQSRVLPDGSLMEIKKVYPLDAVFDNPEDVPEDVKANKRYAGS
SNWTVQEAAECVRQDFGSIDILVHSLGNGPEVSKPLLETSRKGYLAAISA
SSYSFVSLLSHFLPIMNPGGASISLTYIASERIIPGYGGGMSSAKAALES
DTRVLAFEAGRKQNIRVNTISAGPLGSRAAKAIGFIDTMIEYSYNNAPIQ
KTLTADEVGNAAAFLVSPLASAITGATIYVDNGLNSMGVALDSPVF

3D structure

• PDB: 1cwu Inhibitor binding studies on enoyl reductase reveal conformational changes related to substrate recognition.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y198 K206
• Catalytic site (residue number reindexed from 1): Y187 K195
• Enzyme Commision number: 1.3.1.9: enoyl-[acyl-carrier-protein] reductase (NADH).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	G25 I26 G31 Y32 W52 D89 A90 S136 L137 G138 L186 T187 K206 A233 G234 P235 L236 S238 A240	G14 I15 G20 Y21 W41 D78 A79 S125 L126 G127 L175 T176 K195 A222 G223 P224 L225 S227 A229
BS02	TDB	A	G138 N139 Y188 Y198 M202 K206 A240 A241 I244	G127 N128 Y177 Y187 M191 K195 A229 A230 I233

Gene Ontology

Molecular Function

• GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity

Biological Process

• GO:0006633 fatty acid biosynthetic process

External links

• PDB: RCSB:1cwu, PDBe:1cwu, PDBj:1cwu
• PDBsum: 1cwu
• PubMed: 10521472
• UniProt: P80030|FABI_BRANA Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic