Structure of PDB 1cw0 Chain A

Receptor sequence

>1cw0A (length=155) Species: 562 (Escherichia coli)

ADVHDKATRSKNMRAIATRDTAIEKRLASLLTGQGLAFRVQDASLPGRPD
FVVDEYRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDI
SRLQELGWRVLIVWECALRGREKLTDEALTERLEEWICGEGASAQIDTQG
IHLLA

3D structure

• PDB: 1cw0 Recognition of a TG mismatch: the crystal structure of very short patch repair endonuclease in complex with a DNA duplex.
• Chain: A
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D51 T63 H69 D97
• Catalytic site (residue number reindexed from 1): D50 T62 H68 D96
• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	A2 D3 V4 R10 S11 M14 R15 F67 W68 P79 A80 T81 R82 W86 K89 G121 R122	A1 D2 V3 R9 S10 M13 R14 F66 W67 P78 A79 T80 R81 W85 K88 G120 R121
BS02	dna	A	G48 R96 R99	G47 R95 R98
BS03	dna	A	H5 K12 N13 I17 A18 T19 T22 I24 G65 F67 W68 H69 N93	H4 K11 N12 I16 A17 T18 T21 I23 G64 F66 W67 H68 N92
BS04	ZN	A	C66 H71 C73 C117	C65 H70 C72 C116
BS05	MG	A	D51 T63	D50 T62

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0005515 protein binding
• GO:0043765 T/G mismatch-specific endonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006298 mismatch repair

External links

• PDB: RCSB:1cw0, PDBe:1cw0, PDBj:1cw0
• PDBsum: 1cw0
• PubMed: 10612397
• UniProt: P09184|VSR_ECOLI DNA mismatch endonuclease Vsr (Gene Name=vsr)