Structure of PDB 1cvu Chain A

Receptor sequence
>1cvuA (length=552) Species: 10090 (Mus musculus) [Search protein sequence]
ANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLL
KPTPNTVHYILTHFKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYN
VHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKV
LLRREFIPDPQGSNMMFAFFAQHFTAQFFKTDHKRGPGFTRGLGHGVDLN
HIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQVEMIYPPHIPE
NLQFAVGQEVFGLVPGLMMYATIWLREHQRVCDILKQEHPEWGDEQLFQT
SKLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEF
NTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIA
GRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEEL
TGEKEMAAELKALYSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSL
KGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFN
VQ
3D structure
PDB1cvu Structural insights into the stereochemistry of the cyclooxygenase reaction.
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.14.99.1: prostaglandin-endoperoxide synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ACD A I345 Y385 W387 G526 S530 I314 Y354 W356 G495 S499
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0004666 prostaglandin-endoperoxide synthase activity
GO:0005515 protein binding
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0019899 enzyme binding
GO:0020037 heme binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0051213 dioxygenase activity
Biological Process
GO:0001516 prostaglandin biosynthetic process
GO:0001525 angiogenesis
GO:0006979 response to oxidative stress
GO:0007566 embryo implantation
GO:0007612 learning
GO:0007613 memory
GO:0008217 regulation of blood pressure
GO:0008284 positive regulation of cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0009410 response to xenobiotic stimulus
GO:0009624 response to nematode
GO:0009750 response to fructose
GO:0010042 response to manganese ion
GO:0010269 response to selenium ion
GO:0010575 positive regulation of vascular endothelial growth factor production
GO:0019371 cyclooxygenase pathway
GO:0030216 keratinocyte differentiation
GO:0030282 bone mineralization
GO:0031394 positive regulation of prostaglandin biosynthetic process
GO:0031622 positive regulation of fever generation
GO:0031915 positive regulation of synaptic plasticity
GO:0032227 negative regulation of synaptic transmission, dopaminergic
GO:0032310 prostaglandin secretion
GO:0032355 response to estradiol
GO:0032496 response to lipopolysaccharide
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0033280 response to vitamin D
GO:0034097 response to cytokine
GO:0034605 cellular response to heat
GO:0034612 response to tumor necrosis factor
GO:0035633 maintenance of blood-brain barrier
GO:0042127 regulation of cell population proliferation
GO:0042307 positive regulation of protein import into nucleus
GO:0042633 hair cycle
GO:0043065 positive regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
GO:0043154 negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045429 positive regulation of nitric oxide biosynthetic process
GO:0045786 negative regulation of cell cycle
GO:0045907 positive regulation of vasoconstriction
GO:0045986 negative regulation of smooth muscle contraction
GO:0045987 positive regulation of smooth muscle contraction
GO:0046697 decidualization
GO:0048661 positive regulation of smooth muscle cell proliferation
GO:0050873 brown fat cell differentiation
GO:0051384 response to glucocorticoid
GO:0051926 negative regulation of calcium ion transport
GO:0051968 positive regulation of synaptic transmission, glutamatergic
GO:0070542 response to fatty acid
GO:0071222 cellular response to lipopolysaccharide
GO:0071260 cellular response to mechanical stimulus
GO:0071284 cellular response to lead ion
GO:0071318 cellular response to ATP
GO:0071456 cellular response to hypoxia
GO:0071471 cellular response to non-ionic osmotic stress
GO:0071498 cellular response to fluid shear stress
GO:0071636 positive regulation of transforming growth factor beta production
GO:0090050 positive regulation of cell migration involved in sprouting angiogenesis
GO:0090271 positive regulation of fibroblast growth factor production
GO:0090336 positive regulation of brown fat cell differentiation
GO:0090362 positive regulation of platelet-derived growth factor production
GO:0098869 cellular oxidant detoxification
GO:0150077 regulation of neuroinflammatory response
GO:1902219 negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress
GO:1905375 cellular response to homocysteine
GO:1990776 response to angiotensin
Cellular Component
GO:0005634 nucleus
GO:0005637 nuclear inner membrane
GO:0005640 nuclear outer membrane
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005901 caveola
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0043005 neuron projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1cvu, PDBe:1cvu, PDBj:1cvu
PDBsum1cvu
PubMed10811226
UniProtQ05769|PGH2_MOUSE Prostaglandin G/H synthase 2 (Gene Name=Ptgs2)

[Back to BioLiP]