Structure of PDB 1cvj Chain A

Receptor sequence

>1cvjA (length=169) Species: 9606 (Homo sapiens) [Search protein sequence]

ASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSI
DNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNG
MLLNDRKVFVGRFKSRKER

3D structure

PDB

1cvj Recognition of polyadenylate RNA by the poly(A)-binding protein.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	Y14 E24 R41 V42 R44 D45 M46 R49 Y54 Y56 N58 R83 M85 S87 Q88 R89 R94 N100 F102 K104 N105 S127 G139 Y140 F142 H144 F169 F173 K174 S175 R176 R179	Y4 E14 R31 V32 R34 D35 M36 R39 Y44 Y46 N48 R73 M75 S77 Q78 R79 R84 N90 F92 K94 N95 S117 G129 Y130 F132 H134 F159 F163 K164 S165 R166 R169

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

View graph for
Molecular Function

External links

PDB	RCSB:1cvj, PDBe:1cvj, PDBj:1cvj
PDBsum	1cvj
PubMed	10499800
UniProt	P11940\|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]