Structure of PDB 1cuo Chain A |
>1cuoA (length=129) Species: 32038 (Methylomonas sp. J) [Search protein sequence] |
ASCETTVTSGDTMTYSTRSISVPASCAEFTVNFEHKGHMPKTGMGHNWVL AKSADVGDVAKEGAHAGADNNFVTPGDKRVIAFTPIIGGGEKTSVKFKVS ALSKDEAYTYFCSYPGHFSMMRGTLKLEE |
|
PDB | 1cuo The significance of the flexible loop in the azurin (Az-iso2) from the obligate methylotroph Methylomonas sp. strain J. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H46 C112 H117 |
H46 C112 H117 |
|
|
|
|