Structure of PDB 1crb Chain A

Receptor sequence
>1crbA (length=134) Species: 10117 (Rattus rattus) [Search protein sequence]
PVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMI
IRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGE
KEGRGWTQWIEGDELHLEMRAEGVTCKQVFKKVH
3D structure
PDB1crb Crystallographic studies on a family of cellular lipophilic transport proteins. Refinement of P2 myelin protein and the structure determination and refinement of cellular retinol-binding protein in complex with all-trans-retinol.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 RTL A K40 I51 R58 I77 W106 K40 I51 R58 I77 W106
Gene Ontology
Molecular Function
GO:0005504 fatty acid binding
GO:0008289 lipid binding
GO:0016918 retinal binding
GO:0019841 retinol binding
GO:1904768 all-trans-retinol binding
Biological Process
GO:0002138 retinoic acid biosynthetic process
GO:0006776 vitamin A metabolic process
GO:0015908 fatty acid transport
GO:0030852 regulation of granulocyte differentiation
GO:0032526 response to retinoic acid
GO:0033189 response to vitamin A
GO:0042572 retinol metabolic process
GO:0042573 retinoic acid metabolic process
GO:0055088 lipid homeostasis
GO:0080021 response to benzoic acid
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0044297 cell body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1crb, PDBe:1crb, PDBj:1crb
PDBsum1crb
PubMed7683727
UniProtP02696|RET1_RAT Retinol-binding protein 1 (Gene Name=Rbp1)

[Back to BioLiP]