Structure of PDB 1cqt Chain A

Receptor sequence
>1cqtA (length=134) Species: 9606 (Homo sapiens) [Search protein sequence]
EPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFE
ALNLSFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPT
SEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP
3D structure
PDB1cqt Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
ChainA
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A T26 Q27 Q44 T45 S48 R102 K103 R105 T106 I108 N151 T25 Q26 Q43 T44 S47 R75 K76 R78 T79 I81 N124
BS02 dna A F42 S43 T46 R49 S56 N59 R105 K125 R146 R153 Q154 K157 F41 S42 T45 R48 S55 N58 R78 K98 R119 R126 Q127 K130
BS03 peptide A L6 L53 L55 K155 R158 L5 L52 L54 K128 R131
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cqt, PDBe:1cqt, PDBj:1cqt
PDBsum1cqt
PubMed10541551
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]