Structure of PDB 1cpr Chain A

Receptor sequence
>1cprA (length=129) Species: 1061 (Rhodobacter capsulatus) [Search protein sequence]
ADTKEVLEAREAYFKSLGGSMKAMTGVAKAFDAEAAKVEAAKLEKILATD
VAPLFPAGTSSTDLPGQTEAKAAIWANMDDFGAKGKAMHDAGGAVIAAAN
AGDGAAFGAALQKLGGTCKACHDDYREED
3D structure
PDB1cpr Structure of cytochrome c' from Rhodobacter capsulatus strain St Louis: an unusual molecular association induced by bridging Zn ions.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A D32 E34 D32 E34
BS02 HEM A R10 E11 F14 K15 L17 T68 E69 F81 G85 M88 C118 C121 H122 R126 R10 E11 F14 K15 L17 T68 E69 F81 G85 M88 C118 C121 H122 R126
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0022900 electron transport chain
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1cpr, PDBe:1cpr, PDBj:1cpr
PDBsum1cpr
PubMed15299853
UniProtP00147|CYCP_RHOCA Cytochrome c'

[Back to BioLiP]