Structure of PDB 1co6 Chain A

Receptor sequence

>1co6A (length=107) Species: 1079 (Blastochloris viridis)

QDAASGEQVFKQCLVCHSIGPGAKNKVGPVLNGLFGRHSGTIEGFAYSDA
NKNSGITWTEEVFREYIRDPKAKIPGTKMIFAGVKDEQKVSDLIAYIKQF
NADGSKK

3D structure

• PDB: 1co6 Refined crystal structure of ferrocytochrome c2 from Rhodopseudomonas viridis at 1.6 A resolution.
• Chain: A
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C13 C16 H17 P29 S39 Y47 S48 N51 W58 F63 I67 T77 K78 M79 F81	C13 C16 H17 P29 S39 Y47 S48 N51 W58 F63 I67 T77 K78 M79 F81

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis

External links

• PDB: RCSB:1co6, PDBe:1co6, PDBj:1co6
• PDBsum: 1co6
• PubMed: 7674304
• UniProt: P00083|CYC2_BLAVI Cytochrome c2 (Gene Name=cycA)