Structure of PDB 1co0 Chain A

Receptor sequence
>1co0A (length=105) Species: 562 (Escherichia coli) [Search protein sequence]
QSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGT
RVRIVEELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEV
LLKSD
3D structure
PDB1co0 Refined Solution Structures of the Escherichia Coli Trp Holo-and Aporepressor
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A A50 T53 R69 N73 G76 A77 I79 A80 R84 A47 T50 R66 N70 G73 A74 I76 A77 R81
BS02 dna A D46 S67 Q68 R69 K72 I82 T83 D43 S64 Q65 R66 K69 I79 T80
BS03 TRP A R54 I57 T81 R84 G85 R51 I54 T78 R81 G82
BS04 TRP A L43 T44 P45 L40 T41 P42
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1co0, PDBe:1co0, PDBj:1co0
PDBsum1co0
PubMed
UniProtP0A881|TRPR_ECOLI Trp operon repressor (Gene Name=trpR)

[Back to BioLiP]