Structure of PDB 1cml Chain A

Receptor sequence

>1cmlA (length=389) Species: 3879 (Medicago sativa)

MVSVSEIRKAQRAEGPATILAIGTANPANCVEQSTYPDFYFKITNSEHKT
ELKEKFQRMCDKSMIKRRYMYLTEEILKENPNVCEYMAPSLDARQDMVVV
EVPRLGKEAAVKAIKEWGQPKSKITHLIVCTTSGVDMPGADYQLTKLLGL
RPYVKRYMMYQQGAFAGGTVLRLAKDLAENNKGARVLVVCSEVTAVTFRG
PSDTHLDSLVGQALFGDGAAALIVGSDPVPEIEKPIFEMVWTAQTIAPDS
EGAIDGHLREAGLTFHLLKDVPGIVSKNITKALVEAFEPLGISDYNSIFW
IAHPGGPAILDQVEQKLALKPEKMNATREVLSEYGNMSSACVLFILDEMR
KKSTQNGLKTTGEGLEWGVLFGFGPGLTIETVVLRSVAI

3D structure

• PDB: 1cml Structure of chalcone synthase and the molecular basis of plant polyketide biosynthesis.
• Chain: A
• Resolution: 1.69 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): A164 F215 H303 N336
• Catalytic site (residue number reindexed from 1): A164 F215 H303 N336
• Enzyme Commision number: 2.3.1.74: chalcone synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MLC	A	K55 R58 M59 K62 F215 F265 L267 P272 G305 G306 P307 A308	K55 R58 M59 K62 F215 F265 L267 P272 G305 G306 P307 A308
BS02	PIN	A	A164 L214 V271 P272 H303 G305 N336	A164 L214 V271 P272 H303 G305 N336

Gene Ontology

Molecular Function

• GO:0016210 naringenin-chalcone synthase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

Biological Process

• GO:0009058 biosynthetic process
• GO:0009715 chalcone biosynthetic process
• GO:0009813 flavonoid biosynthetic process
• GO:0030639 polyketide biosynthetic process

External links

• PDB: RCSB:1cml, PDBe:1cml, PDBj:1cml
• PDBsum: 1cml
• PubMed: 10426957
• UniProt: P30074|CHS2_MEDSA Chalcone synthase 2 (Gene Name=CHS2)