Structure of PDB 1cma Chain A

Receptor sequence
>1cmaA (length=104) Species: 562 (Escherichia coli) [Search protein sequence]
AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRH
ATNSELLCEAFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPE
TWEY
3D structure
PDB1cma Crystal structure of the met repressor-operator complex at 2.8 A resolution reveals DNA recognition by beta-strands.
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K17 K23 T52 N53 S54 K17 K23 T52 N53 S54
BS02 SAM A A64 F65 A64 F65
BS03 SAM A E39 R43 L56 E59 H63 E39 R43 L56 E59 H63
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006555 methionine metabolic process
GO:0009086 methionine biosynthetic process
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1cma, PDBe:1cma, PDBj:1cma
PDBsum1cma
PubMed1406951
UniProtP0A8U6|METJ_ECOLI Met repressor (Gene Name=metJ)

[Back to BioLiP]