Structure of PDB 1cm8 Chain A

Receptor sequence
>1cm8A (length=329) Species: 9606 (Homo sapiens) [Search protein sequence]
RSGFYRQEVTKTAWEVRAVYRDLQPVAVCSAVDGRTGAKVAIKKLYRPFQ
SELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMG
TDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNE
DCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVG
CIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMK
GLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFES
LHQVQKYDDSRTLDEWKRVTYKEVLSFKP
3D structure
PDB1cm8 The structure of phosphorylated p38gamma is monomeric and reveals a conserved activation-loop conformation.
ChainA
Resolution2.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D153 K155 N158 D171 T188
Catalytic site (residue number reindexed from 1) D140 K142 N145 D158 T175
Enzyme Commision number 2.7.11.24: mitogen-activated protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ANP A V41 A54 K56 M109 P110 F111 M112 D115 K155 G157 N158 L170 D171 V28 A41 K43 M96 P97 F98 M99 D102 K142 G144 N145 L157 D158
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004707 MAP kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0046872 metal ion binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000165 MAPK cascade
GO:0006468 protein phosphorylation
GO:0007165 signal transduction
GO:0007517 muscle organ development
GO:0010952 positive regulation of peptidase activity
GO:0016310 phosphorylation
GO:0018105 peptidyl-serine phosphorylation
GO:0033554 cellular response to stress
GO:0035556 intracellular signal transduction
GO:0042770 signal transduction in response to DNA damage
GO:0045445 myoblast differentiation
GO:0045786 negative regulation of cell cycle
GO:0051149 positive regulation of muscle cell differentiation
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1cm8, PDBe:1cm8, PDBj:1cm8
PDBsum1cm8
PubMed10508788
UniProtP53778|MK12_HUMAN Mitogen-activated protein kinase 12 (Gene Name=MAPK12)

[Back to BioLiP]