Structure of PDB 1clm Chain A

Receptor sequence
>1clmA (length=144) Species: 5888 (Paramecium tetraurelia) [Search protein sequence]
LTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISAA
ELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS
3D structure
PDB1clm Structure of Paramecium tetraurelia calmodulin at 1.8 A resolution.
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V32
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D20 D22 D24 T26 E31 D17 D19 D21 T23 E28
BS02 CA A D56 D58 N60 T62 E67 D53 D55 N57 T59 E64
BS03 CA A D93 D95 N97 L99 E104 D90 D92 N94 L96 E101
BS04 CA A D129 D131 D133 H135 E140 D126 D128 D130 H132 E137
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0030234 enzyme regulator activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:1clm, PDBe:1clm, PDBj:1clm
PDBsum1clm
PubMed8453381
UniProtP07463|CALM_PARTE Calmodulin (Gene Name=CAM)

[Back to BioLiP]