Structure of PDB 1cir Chain A

Receptor sequence
>1cirA (length=39) Species: 4513 (Hordeum vulgare) [Search protein sequence]
MKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVT
3D structure
PDB1cir Towards the complete structural characterization of a protein folding pathway: the structures of the denatured, transition and native states for the association/folding of two complementary fragments of cleaved chymotrypsin inhibitor 2. Direct evidence for a nucleation-condensation mechanism
ChainA
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A T3 E4 W5 L8 G10 K11 S12 V13 A16 P25 A27 Q28 I29 I30 L32 V34 T3 E4 W5 L8 G10 K11 S12 V13 A16 P25 A27 Q28 I29 I30 L32 V34
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
Biological Process
GO:0009611 response to wounding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cir, PDBe:1cir, PDBj:1cir
PDBsum1cir
PubMed9079381
UniProtP01053|ICI2_HORVU Subtilisin-chymotrypsin inhibitor-2A

[Back to BioLiP]