Structure of PDB 1ciq Chain A

Receptor sequence
>1ciqA (length=37) Species: 4513 (Hordeum vulgare) [Search protein sequence]
KTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIV
3D structure
PDB1ciq Towards the complete structural characterization of a protein folding pathway: the structures of the denatured, transition and native states for the association/folding of two complementary fragments of cleaved chymotrypsin inhibitor 2. Direct evidence for a nucleation-condensation mechanism
ChainA
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A T3 E4 W5 P6 L8 V9 G10 K11 S12 V13 I20 K24 A27 Q28 I29 I30 V31 L32 P33 V34 T2 E3 W4 P5 L7 V8 G9 K10 S11 V12 I19 K23 A26 Q27 I28 I29 V30 L31 P32 V33
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
Biological Process
GO:0009611 response to wounding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ciq, PDBe:1ciq, PDBj:1ciq
PDBsum1ciq
PubMed9079381
UniProtP01053|ICI2_HORVU Subtilisin-chymotrypsin inhibitor-2A

[Back to BioLiP]