Structure of PDB 1ch8 Chain A

Receptor sequence

>1ch8A (length=431) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKT
VLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGIPVRERLLLS
EACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGD
LFDKETFAEKLKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSM
VVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVAT
GSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGAT
TGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMP
DGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA

3D structure

PDB

1ch8 Effectors of the stringent response target the active site of Escherichia coli adenylosuccinate synthetase.

Chain

Resolution

2.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D13 K16 G40 H41 Q224
Catalytic site (residue number reindexed from 1)	D13 K16 G40 H41 Q224
Enzyme Commision number	6.3.4.4: adenylosuccinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D13 G40	D13 G40
BS02	GPX	A	D13 G15 K16 G17 G40 H41 T42 K49 R305 K331 D333 S414 G416 P417	D13 G15 K16 G17 G40 H41 T42 K49 R305 K331 D333 S414 G416 P417	PDBbind-CN: -logKd/Ki=7.00,Ki=0.1uM
BS03	HDA	A	D13 G40 T129 G298 A299 T300 T301 R303 R305	D13 G40 T129 G298 A299 T300 T301 R303 R305
BS04	IMP	A	D13 N38 A39 I126 G127 T128 T129 Q224 T239 V273 R303	D13 N38 A39 I126 G127 T128 T129 Q224 T239 V273 R303

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0000287	magnesium ion binding
GO:0004019	adenylosuccinate synthase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016874	ligase activity
GO:0046872	metal ion binding
GO:0097216	guanosine tetraphosphate binding

	Biological Process
GO:0006164	purine nucleotide biosynthetic process
GO:0006974	DNA damage response
GO:0015949	nucleobase-containing small molecule interconversion
GO:0044208	'de novo' AMP biosynthetic process
GO:0046040	IMP metabolic process
GO:0046086	adenosine biosynthetic process

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ch8, PDBe:1ch8, PDBj:1ch8
PDBsum	1ch8
PubMed	10364182
UniProt	P0A7D4\|PURA_ECOLI Adenylosuccinate synthetase (Gene Name=purA)

[Back to BioLiP]