Structure of PDB 1cdw Chain A

Receptor sequence

>1cdwA (length=179) Species: 9606 (Homo sapiens) [Search protein sequence]

SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPR
TTALIFSSGKMVCTGAKSEENSRLAARKYARVVQKLGFPAKFLDFKIQNM
VGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSG
KVVLTGAKVRAEIYEAFENIYPILKGFRK

3D structure

PDB

1cdw Crystal structure of a human TATA box-binding protein/TATA element complex.

Chain

Resolution

1.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	V165 A194 F210 S212 K214 V216 Q252 N253 L283 F284 I288 R290 L299 T309	V11 A40 F56 S58 K60 V62 Q98 N99 L129 F130 I134 R136 L145 T155
BS02	dna	A	Q162 N163 R192 F193 I197 R199 R204 T206 L208 T218 V255 F284 P285 F301 S303 K305 V307	Q8 N9 R38 F39 I43 R45 R50 T52 L54 T64 V101 F130 P131 F147 S149 K151 V153

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1cdw, PDBe:1cdw, PDBj:1cdw
PDBsum	1cdw
PubMed	8643494
UniProt	P20226\|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]