Structure of PDB 1cdm Chain A

Receptor sequence

>1cdmA (length=133) Species: 9913 (Bos taurus)

LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLTMMAEIREAFRVFDKDGNGYISAAELRHVMTNLG
EKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT

3D structure

• PDB: 1cdm Modulation of calmodulin plasticity in molecular recognition on the basis of x-ray structures.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): V35
• Catalytic site (residue number reindexed from 1): V32

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	E7 A10 E11 E14 A15 L18 F19 M36 M72 E84 F92 M109 E114 E120 M124 E127 M144 M145	E4 A7 E8 E11 A12 L15 F16 M33 M69 E71 F79 M96 E101 E107 M111 E114 M131 M132
BS02	CA	A	D20 D22 D24 T26 E31	D17 D19 D21 T23 E28
BS03	CA	A	D56 D58 N60 T62 E67	D53 D55 N57 T59 E64
BS04	CA	A	D93 D95 N97 Y99 E104	D80 D82 N84 Y86 E91
BS05	CA	A	D129 D131 D133 Q135 E140	D116 D118 D120 Q122 E127

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0019904 protein domain specific binding
• GO:0046872 metal ion binding

Biological Process

• GO:0010880 regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
• GO:0060315 negative regulation of ryanodine-sensitive calcium-release channel activity
• GO:0060316 positive regulation of ryanodine-sensitive calcium-release channel activity

Cellular Component

• GO:0000922 spindle pole
• GO:0005737 cytoplasm
• GO:0005819 spindle
• GO:0005829 cytosol
• GO:0005856 cytoskeleton
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:1cdm, PDBe:1cdm, PDBj:1cdm
• PDBsum: 1cdm
• PubMed: 8259515
• UniProt: P62157|CALM_BOVIN Calmodulin (Gene Name=CALM)