Structure of PDB 1ccr Chain A

Receptor sequence

>1ccrA (length=111) Species: 4530 (Oryza sativa)

ASFSEAPPGNPKAGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGT
TPGYSYSTADKNMAVIWEENTLYDYLLNPKKYIPGTKMVFPGLKKPQERA
DLISYLKEATS

3D structure

• PDB: 1ccr Structure of rice ferricytochrome c at 2.0 A resolution.
• Chain: A
• Resolution: 1.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	K21 C22 C25 H26 Q36 G37 P38 S48 Y54 Y56 S57 D60 W67 Y75 T86 K87 M88 F90	K21 C22 C25 H26 Q36 G37 P38 S48 Y54 Y56 S57 D60 W67 Y75 T86 K87 M88 F90

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:1ccr, PDBe:1ccr, PDBj:1ccr
• PDBsum: 1ccr
• PubMed: 6304326
• UniProt: Q0DI31|CYC_ORYSJ Cytochrome c (Gene Name=CC-1)