Structure of PDB 1cbr Chain A

Receptor sequence

>1cbrA (length=136) Species: 10090 (Mus musculus)

PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQF
YIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLL
EGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

3D structure

• PDB: 1cbr Crystal structures of cellular retinoic acid binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid.
• Chain: A
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	REA	A	L120 R131 Y133	L120 R131 Y133	PDBbind-CN: -logKd/Ki=9.40,Kd=0.4nM BindingDB: Kd=>200nM

Gene Ontology

Molecular Function

• GO:0005501 retinoid binding
• GO:0008289 lipid binding
• GO:0016918 retinal binding
• GO:0019841 retinol binding

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1cbr, PDBe:1cbr, PDBj:1cbr
• PDBsum: 1cbr
• PubMed: 7704533
• UniProt: P62965|RABP1_MOUSE Cellular retinoic acid-binding protein 1 (Gene Name=Crabp1)