Structure of PDB 1bzs Chain A

Receptor sequence
>1bzsA (length=165) Species: 9606 (Homo sapiens) [Search protein sequence]
FMLTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIF
TRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDA
EETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYS
LPQDDIDGIQAIYGD
3D structure
PDB1bzs Quantitative structure-activity relationship of human neutrophil collagenase (MMP-8) inhibitors using comparative molecular field analysis and X-ray structure analysis.
ChainA
Resolution1.7 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H197 E198 H201 H207
Catalytic site (residue number reindexed from 1) H119 E120 H123 H129
Enzyme Commision number 3.4.24.34: neutrophil collagenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D137 G169 G171 D173 D59 G91 G93 D95
BS02 CA A D154 G155 N157 I159 D177 E180 D76 G77 N79 I81 D99 E102
BS03 ZN A H147 D149 H162 H175 H69 D71 H84 H97
BS04 ZN A H197 H201 H207 H119 H123 H129
BS05 BSI A I159 L160 A161 H197 E198 H201 H207 L214 P217 N218 Y219 I81 L82 A83 H119 E120 H123 H129 L136 P139 N140 Y141 MOAD: ic50=10nM
PDBbind-CN: -logKd/Ki=8.00,IC50=10nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bzs, PDBe:1bzs, PDBj:1bzs
PDBsum1bzs
PubMed10354399
UniProtP22894|MMP8_HUMAN Neutrophil collagenase (Gene Name=MMP8)

[Back to BioLiP]