Structure of PDB 1bzl Chain A

Receptor sequence

>1bzlA (length=486) Species: 5693 (Trypanosoma cruzi) [Search protein sequence]

MSKIFDLVVIGAGSGGLEAAWNAATLYKKRVAVIDVQMVHGPPFFSALGG
TCVNVGCVPKKLMVTGAQYMEHLRESAGFGWEFDRTTLRAEWKNLIAVKD
EAVLNINKSYDEMFRDTEGLEFFLGWGSLESKNVVNVRESADPASAVKER
LETEHILLASGSWPHMPNIPGIEHCISSNEAFYLPEPPRRVLTVGGGFIS
VEFAGIFNAYKPKDGQVTLCYRGEMILRGFDHTLREELTKQLTANGIQIL
TKENPAKVELNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAG
VMIKNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFG
TTPRKTDHTRVASAVFSIPPIGTCGLIEEVASKRYEVVAVYLSSFTPLMH
KVSGSKYKTFVAKIITNHSDGTVLGVHLLGDNAPEIIQGIGICLKLNAKI
SDFYNTIGVHPTSAEELCSMRTPSYYYVKGEKMEKP

3D structure

PDB

1bzl Crystal structure of Trypanosoma cruzi trypanothione reductase in complex with trypanothione, and the structure-based discovery of new natural product inhibitors.

Chain

Resolution

2.4 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	S15 L49 C53 C58 K61 R86 T87 F199 E203 I339 G459 H461 E466 E485 K486
Catalytic site (residue number reindexed from 1)	S14 L48 C52 C57 K60 R85 T86 F198 E202 I338 G458 H460 E465 E484 K485
Enzyme Commision number	1.8.1.12: trypanothione-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FAD	A	G12 G14 S15 G16 D36 S47 G51 T52 C53 V56 G57 C58 K61 G128 S161 G162 R288 R291 G326 D327 M333 L334 T335	G11 G13 S14 G15 D35 S46 G50 T51 C52 V55 G56 C57 K60 G127 S160 G161 R287 R290 G325 D326 M332 L333 T334
BS02	GCG	A	L18 E19 V59 S110 Y111 I339	L17 E18 V58 S109 Y110 I338
BS03	GCG	A	F396 P398 G459 H461 T463 E466	F395 P397 G458 H460 T462 E465

Gene Ontology

	Molecular Function
GO:0004362	glutathione-disulfide reductase (NADPH) activity
GO:0015036	disulfide oxidoreductase activity
GO:0015042	trypanothione-disulfide reductase (NADPH) activity
GO:0016491	oxidoreductase activity
GO:0016668	oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
GO:0050660	flavin adenine dinucleotide binding

	Biological Process
GO:0006749	glutathione metabolic process
GO:0034599	cellular response to oxidative stress
GO:0045454	cell redox homeostasis
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1bzl, PDBe:1bzl, PDBj:1bzl
PDBsum	1bzl
PubMed	10368274
UniProt	P28593\|TYTR_TRYCR Trypanothione reductase (Gene Name=TPR)

[Back to BioLiP]