Structure of PDB 1bxu Chain A

Receptor sequence
>1bxuA (length=91) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) [Search protein sequence]
QTVAIKMGADNGMLAFEPSTIEIQAGDTVQWVNNKLAPHNVVVEGQPELS
HKDLAFSPGETFEATFSEPGTYTYYCEPHRGAGMVGKIVVQ
3D structure
PDB1bxu Crystal structure determinations of oxidized and reduced plastocyanin from the cyanobacterium Synechococcus sp. PCC 7942.
ChainA
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H37 C84 H87 M92
Catalytic site (residue number reindexed from 1) H39 C76 H79 M84
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU A H37 C84 H87 H39 C76 H79
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
Cellular Component
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1bxu, PDBe:1bxu, PDBj:1bxu
PDBsum1bxu
PubMed10320332
UniProtP55020|PLAS_SYNE7 Plastocyanin (Gene Name=petE)

[Back to BioLiP]