Structure of PDB 1bvb Chain A

Receptor sequence

>1bvbA (length=211) Species: 915 (Nitrosomonas europaea)

ADAPFEGRKKCSSCHKAQAQSWKDTAHAKAMESLKPNVKKEAKQKAKLDP
AKDYTQDKDCVGCHVDGFGQKGGYTIESPKPMLTGVGCESCHGPGRNFRG
DHRKSGQAFEKSGKKTPRKDLAKKGQDFHFEERCSACHLNYEGSPWKGAK
APYTPFTPEVDAKYTFKFDEMVKEVKAMHEHYKLEGVFEGEPKFKFHDEF
QASAKPAKKGK

3D structure

• PDB: 1bvb Heme packing motifs revealed by the crystal structure of the tetra-heme cytochrome c554 from Nitrosomonas europaea.
• Chain: A
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	K10 C11 C14 H15 H92 F98 H102 R103 R118 Q126 L184 E185 G186 V187 K211	K10 C11 C14 H15 H92 F98 H102 R103 R118 Q126 L184 E185 G186 V187 K211
BS02	HEM	A	S33 L34 K39 A42 Y54 D59 C60 C63 H64 C137 H138 N140 P152 T154 P155 F156 Y164	S33 L34 K39 A42 Y54 D59 C60 C63 H64 C137 H138 N140 P152 T154 P155 F156 Y164
BS03	HEM	A	C11 H15 Q18 A19 W22 H27 G87 C88 C91 H92 F130 M178 H179 H181 Y182 L184 F194 H197	C11 H15 Q18 A19 W22 H27 G87 C88 C91 H92 F130 M178 H179 H181 Y182 L184 F194 H197
BS04	HEM	A	A26 H27 S33 C63 H64 V86 R133 C134 C137 H138 F166 A177 M178	A26 H27 S33 C63 H64 V86 R133 C134 C137 H138 F166 A177 M178

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1bvb, PDBe:1bvb, PDBj:1bvb
• PDBsum: 1bvb
• PubMed: 9808046
• UniProt: Q57142|C554_NITEU Cytochrome c-554 (Gene Name=cycA1)