Structure of PDB 1bt6 Chain A

Receptor sequence
>1bt6A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence]
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLA
VDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMK
3D structure
PDB1bt6 The crystal structure of a complex of p11 with the annexin II N-terminal peptide.
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A P1 E5 E9 P1 E5 E9
BS02 peptide A F41 N44 Q45 C82 Y85 M90 F41 N44 Q45 C82 Y85 M90
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0042803 protein homodimerization activity
GO:0044325 transmembrane transporter binding
GO:0048306 calcium-dependent protein binding
Biological Process
GO:0001765 membrane raft assembly
GO:0006900 vesicle budding from membrane
GO:0010756 positive regulation of plasminogen activation
GO:0042789 mRNA transcription by RNA polymerase II
GO:0043547 positive regulation of GTPase activity
GO:0045921 positive regulation of exocytosis
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0050767 regulation of neurogenesis
GO:0051496 positive regulation of stress fiber assembly
GO:0051894 positive regulation of focal adhesion assembly
GO:0072659 protein localization to plasma membrane
GO:1900026 positive regulation of substrate adhesion-dependent cell spreading
GO:1905686 positive regulation of plasma membrane repair
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0016363 nuclear matrix
GO:0045121 membrane raft
GO:0062023 collagen-containing extracellular matrix
GO:0070062 extracellular exosome
GO:0090575 RNA polymerase II transcription regulator complex
GO:0098797 plasma membrane protein complex
GO:1990665 AnxA2-p11 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bt6, PDBe:1bt6, PDBj:1bt6
PDBsum1bt6
PubMed9886297
UniProtP60903|S10AA_HUMAN Protein S100-A10 (Gene Name=S100A10)

[Back to BioLiP]