Structure of PDB 1bsv Chain A

Receptor sequence

>1bsvA (length=317) Species: 83333 (Escherichia coli K-12)

KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFA
SERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKL
LFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNR
QYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQNAPDVVVW
GSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCT
IRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLE
AGLASTYQWFLENQDRF

3D structure

• PDB: 1bsv GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S107 S108 C109 Y136 K140 H179
• Catalytic site (residue number reindexed from 1): S105 S106 C107 Y134 K138 H177
• Enzyme Commision number: 1.1.1.271: GDP-L-fucose synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	A	R12 G13 M14 V15 R36 L41 A64 V66 G106 Y136 K140 L166	R10 G11 M12 V13 R34 L39 A62 V64 G104 Y134 K138 L164

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0016853 isomerase activity
• GO:0042803 protein homodimerization activity
• GO:0050577 GDP-L-fucose synthase activity
• GO:0070401 NADP+ binding

Biological Process

• GO:0009226 nucleotide-sugar biosynthetic process
• GO:0009242 colanic acid biosynthetic process
• GO:0042351 'de novo' GDP-L-fucose biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1bsv, PDBe:1bsv, PDBj:1bsv
• PDBsum: 1bsv
• PubMed: 9862812
• UniProt: P32055|FCL_ECOLI GDP-L-fucose synthase (Gene Name=fcl)