Structure of PDB 1brr Chain A

Receptor sequence
>1brrA (length=230) Species: 2242 (Halobacterium salinarum) [Search protein sequence]
QITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAI
AFTMYLSMLLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVD
ADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYVL
FFGFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPLN
IETLLFMVLDVSAKVGFGLILLRSRAIFGE
3D structure
PDB1brr Lipid patches in membrane protein oligomers: crystal structure of the bacteriorhodopsin-lipid complex
ChainA
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MAN A L66 T67 L64 T65
BS02 RET A W86 T90 M118 W138 S141 T142 M145 W182 Y185 P186 K216 W84 T88 M116 W136 S139 T140 M143 W180 Y183 P184 K214
BS03 ARC A T107 A110 Y147 T105 A108 Y145
BS04 ARC A W80 L123 W78 L121
BS05 ARC A G113 G116 I117 G120 G111 G114 I115 G118
BS06 ARC A L28 Y43 A44 T47 L26 Y41 A42 T45
BS07 ARC A W80 F88 W78 F86
Gene Ontology
Molecular Function
GO:0005216 monoatomic ion channel activity
GO:0009881 photoreceptor activity
GO:0015454 light-driven active monoatomic ion transmembrane transporter activity
Biological Process
GO:0006811 monoatomic ion transport
GO:0007602 phototransduction
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1brr, PDBe:1brr, PDBj:1brr
PDBsum1brr
PubMed9751724
UniProtP02945|BACR_HALSA Bacteriorhodopsin (Gene Name=bop)

[Back to BioLiP]