Structure of PDB 1bqk Chain A

Receptor sequence
>1bqkA (length=124) Species: 223 (Achromobacter cycloclastes) [Search protein sequence]
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIP
DGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLE
AVKGAKNPKKAQERLDAALAALGN
3D structure
PDB1bqk Crystal structure determinations of oxidized and reduced pseudoazurins from Achromobacter cycloclastes. Concerted movement of copper site in redox forms with the rearrangement of hydrogen bond at a remote histidine.
ChainA
Resolution1.35 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H40 C78 H81 M86
Catalytic site (residue number reindexed from 1) H40 C78 H81 M86
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU A H40 C78 H81 M86 H40 C78 H81 M86
Gene Ontology
Molecular Function
GO:0005507 copper ion binding
GO:0009055 electron transfer activity
GO:0046872 metal ion binding
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1bqk, PDBe:1bqk, PDBj:1bqk
PDBsum1bqk
PubMed10364229
UniProtP19567|AZUP_ACHCY Pseudoazurin (Gene Name=bcp)

[Back to BioLiP]