Structure of PDB 1bq8 Chain A |
>1bq8A (length=54) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] |
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFE KLED |
|
PDB | 1bq8 Crystal Structure of Rubredoxin from Pyrococcus Furiosus at 0.95 Angstroms Resolution, and the structures of N-terminal methionine and formylmethionine variants of Pf Rd. Contributions of N-terminal interactions to thermostability |
Chain | A |
Resolution | 1.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
C6 C9 C39 C42 |
C6 C9 C39 C42 |
|
|
|
|