Structure of PDB 1bp3 Chain A

Receptor sequence

>1bp3A (length=186) Species: 9606 (Homo sapiens) [Search protein sequence]

FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQT
SLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANS
LVYGASDSNVYDLLKDLEERIQTLMGRLEDGSPRTGQIFKQTYSKFDTDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCG

3D structure

PDB

1bp3 The X-ray structure of a growth hormone-prolactin receptor complex.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	H18 E174	H18 E170

Gene Ontology

	Molecular Function
GO:0005125	cytokine activity
GO:0005131	growth hormone receptor binding
GO:0005148	prolactin receptor binding
GO:0005179	hormone activity
GO:0005515	protein binding
GO:0008083	growth factor activity
GO:0046872	metal ion binding
GO:0070186	growth hormone activity

	Biological Process
GO:0002092	positive regulation of receptor internalization
GO:0007259	cell surface receptor signaling pathway via JAK-STAT
GO:0010828	positive regulation of D-glucose transmembrane transport
GO:0019221	cytokine-mediated signaling pathway
GO:0031667	response to nutrient levels
GO:0032355	response to estradiol
GO:0040018	positive regulation of multicellular organism growth
GO:0043406	positive regulation of MAP kinase activity
GO:0043568	positive regulation of insulin-like growth factor receptor signaling pathway
GO:0045927	positive regulation of growth
GO:0046427	positive regulation of receptor signaling pathway via JAK-STAT
GO:0048513	animal organ development
GO:0051897	positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0060396	growth hormone receptor signaling pathway
GO:0060397	growth hormone receptor signaling pathway via JAK-STAT
GO:0070977	bone maturation
GO:0097696	cell surface receptor signaling pathway via STAT

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0031904	endosome lumen
GO:0062023	collagen-containing extracellular matrix
GO:0070195	growth hormone receptor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1bp3, PDBe:1bp3, PDBj:1bp3
PDBsum	1bp3
PubMed	7984244
UniProt	P01241\|SOMA_HUMAN Somatotropin (Gene Name=GH1)

[Back to BioLiP]