Structure of PDB 1bos Chain A

Receptor sequence
>1bosA (length=69) Species: 12371 (Phage h30) [Search protein sequence]
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTV
TIKTNACHNGGGFSEVIFR
3D structure
PDB1bos Structure of the shiga-like toxin I B-pentamer complexed with an analogue of its receptor Gb3.
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GAL A T1154 N1155 G1162 T54 N55 G62
BS02 GLA A N1132 R1133 F1163 N32 R33 F63
BS03 GLA A R1133 W1134 N1135 R33 W34 N35
BS04 GAL A D1117 F1130 G1160 D17 F30 G60
BS05 GLA A N1115 T1121 E1128 G1160 N15 T21 E28 G60
BS06 GLA A D1118 W1134 D18 W34
Gene Ontology
Biological Process
GO:0019836 hemolysis by symbiont of host erythrocytes
GO:0098676 modulation of host virulence by virus
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bos, PDBe:1bos, PDBj:1bos
PDBsum1bos
PubMed9485303
UniProtP69179|STXB_BPH19 Shiga-like toxin 1 subunit B (Gene Name=stxB)

[Back to BioLiP]