Structure of PDB 1bl0 Chain A

Receptor sequence
>1bl0A (length=116) Species: 562 (Escherichia coli) [Search protein sequence]
DAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQ
YIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHK
YRMTNMQGESRFLHPL
3D structure
PDB1bl0 A novel DNA-binding motif in MarA: the first structure for an AraC family transcriptional activator.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A L30 E31 Q45 R46 K49 S55 G57 Q92 T95 K99 P105 H107 L22 E23 Q37 R38 K41 S47 G49 Q84 T87 K91 P97 H99
BS02 dna A Y39 S40 W42 H43 R46 R61 R96 T97 Y31 S32 W34 H35 R38 R53 R88 T89
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0046677 response to antibiotic

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1bl0, PDBe:1bl0, PDBj:1bl0
PDBsum1bl0
PubMed9724717
UniProtP0ACH5|MARA_ECOLI Multiple antibiotic resistance protein MarA (Gene Name=marA)

[Back to BioLiP]