Structure of PDB 1bj3 Chain A |
>1bj3A (length=129) Species: 88087 (Protobothrops flavoviridis) [Search protein sequence] |
DCPSGWSSYEGHCYKPFKLYKTWDDAERFCTEQAKGGHLVSIESAGEADF VAQLVTENIQNTKSYVWIGLRVQGKEKQCSSEWSDGSSVSYENWIEAESK TCLGLEKETGFRKWVNIYCGQQNPFVCEA |
|
PDB | 1bj3 Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region. |
Chain | A |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
S41 E43 E47 E128 |
S41 E43 E47 E128 |
|
|
|
|