Structure of PDB 1bh2 Chain A

Receptor sequence

>1bh2A (length=315) Species: 10116 (Rattus norvegicus)

REVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSI
IAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGFMTAELAGVIKRLW
KDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKT
TGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYD
LVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKS
PLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCSTDTKN
VQFVFDAVTDVIIKN

3D structure

• PDB: 1bh2 The A326S mutant of Gialpha1 as an approximation of the receptor-bound state.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E43 T48 R178 D200 Q204
• Catalytic site (residue number reindexed from 1): E12 T17 R147 D169 Q173

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	S47 T181	S16 T150
BS02	GSP	A	E43 S44 G45 K46 S47 T48 R176 T177 R178 K180 T181 G202 G203 Q204 N269 K270 D272 L273 C325 S326 T327	E12 S13 G14 K15 S16 T17 R145 T146 R147 K149 T150 G171 G172 Q173 N238 K239 D241 L242 C294 S295 T296

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding
• GO:0019001 guanyl nucleotide binding
• GO:0031683 G-protein beta/gamma-subunit complex binding

Biological Process

• GO:0007165 signal transduction
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway

External links

• PDB: RCSB:1bh2, PDBe:1bh2, PDBj:1bh2
• PDBsum: 1bh2
• PubMed: 9705312
• UniProt: P10824|GNAI1_RAT Guanine nucleotide-binding protein G(i) subunit alpha-1 (Gene Name=Gnai1)