Structure of PDB 1bff Chain A |
>1bffA (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] |
KDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKG VCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVA LKRTGQYKLGSKTGPGQKAILFLPMSAKS |
|
PDB | 1bff X-ray structure of the 154-amino-acid form of recombinant human basic fibroblast growth factor. comparison with the truncated 146-amino-acid form. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PO4 |
A |
N35 R128 K133 |
N10 R103 K108 |
|
|
|
|