Structure of PDB 1bdo Chain A

Receptor sequence

>1bdoA (length=80) Species: 562 (Escherichia coli)

EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQ
IEADKSGTVKAILVESGQPVEFDEPLVVIE

3D structure

• PDB: 1bdo Structure of the biotinyl domain of acetyl-coenzyme A carboxylase determined by MAD phasing.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 6.4.1.2: acetyl-CoA carboxylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BTN	A	Y92 T94 P95 S96 P97 K122 M124	Y16 T18 P19 S20 P21 K46 M48

Gene Ontology

Molecular Function

• GO:0003989 acetyl-CoA carboxylase activity

Biological Process

• GO:0006633 fatty acid biosynthetic process

Cellular Component

• GO:0009317 acetyl-CoA carboxylase complex

External links

• PDB: RCSB:1bdo, PDBe:1bdo, PDBj:1bdo
• PDBsum: 1bdo
• PubMed: 8747466
• UniProt: P0ABD8|BCCP_ECOLI Biotin carboxyl carrier protein of acetyl-CoA carboxylase (Gene Name=accB)