Structure of PDB 1bcz Chain A

Receptor sequence
>1bczA (length=318) Species: 10116 (Rattus norvegicus) [Search protein sequence]
ALRGTVTDFSGFDGRADAEVLRKAMKGLGTDEDSILNLLTARSNAQRQQI
AEEFKTLFGRDLVNDMKSELSGKFEKLIVALMKPSRLYDAYELKHALKGA
GTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRML
VVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITILGTRSV
SHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVKSIRSIPAYLAE
TLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKGD
TSGDYKKALLLLCGGEDD
3D structure
PDB1bcz Mutational and crystallographic analyses of interfacial residues in annexin V suggest direct interactions with phospholipid membrane components.
ChainA
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA A M26 G28 G30 E70 M25 G27 G29 E69
BS02 CA A K68 L71 S72 E76 K67 L70 S71 E75
BS03 CA A G181 K184 G186 E226 G180 K183 G185 E225
BS04 CA A D224 T227 E232 D223 T226 E231
BS05 CA A M257 G259 A260 G261 D301 M256 G258 A259 G260 D300
Gene Ontology
Molecular Function
GO:0001786 phosphatidylserine binding
GO:0005388 P-type calcium transporter activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0005544 calcium-dependent phospholipid binding
GO:0017046 peptide hormone binding
GO:0030971 receptor tyrosine kinase binding
GO:0042802 identical protein binding
Biological Process
GO:0007596 blood coagulation
GO:0030195 negative regulation of blood coagulation
GO:0043065 positive regulation of apoptotic process
GO:0050819 negative regulation of coagulation
GO:0051592 response to calcium ion
GO:0070588 calcium ion transmembrane transport
GO:0071284 cellular response to lead ion
GO:0097066 response to thyroid hormone
GO:0097211 cellular response to gonadotropin-releasing hormone
GO:1901317 regulation of flagellated sperm motility
GO:1902721 negative regulation of prolactin secretion
Cellular Component
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0008021 synaptic vesicle
GO:0009897 external side of plasma membrane
GO:0012506 vesicle membrane
GO:0014704 intercalated disc
GO:0030018 Z disc
GO:0030425 dendrite
GO:0030672 synaptic vesicle membrane
GO:0042383 sarcolemma
GO:0042995 cell projection
GO:0043025 neuronal cell body
GO:0043204 perikaryon
GO:0043679 axon terminus
GO:0072563 endothelial microparticle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1bcz, PDBe:1bcz, PDBj:1bcz
PDBsum1bcz
PubMed9609693
UniProtP14668|ANXA5_RAT Annexin A5 (Gene Name=Anxa5)

[Back to BioLiP]