Structure of PDB 1b7f Chain A

Receptor sequence

>1b7fA (length=167) Species: 7227 (Drosophila melanogaster) [Search protein sequence]

SNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSYGYAFVD
FTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTI
TDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISAL
NNVIPEGGSQPLSVRLA

3D structure

PDB

1b7f Structural basis for recognition of the tra mRNA precursor by the Sex-lethal protein.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	N130 Y131 Q134 R155 M157 R158 Y160 Y164 S165 Y166 Y168 F170 K194 R195 K197 A201 R202 G204 Y214 T216 N217 Q239 N241 L243 R252 V254 F256 R258 A289	N8 Y9 Q12 R33 M35 R36 Y38 Y42 S43 Y44 Y46 F48 K72 R73 K75 A79 R80 G82 Y92 T94 N95 Q117 N119 L121 R130 V132 F134 R136 A167

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

	Cellular Component
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:1b7f, PDBe:1b7f, PDBj:1b7f
PDBsum	1b7f
PubMed	10217141
UniProt	P19339\|SXL_DROME Protein sex-lethal (Gene Name=Sxl)

[Back to BioLiP]