Structure of PDB 1b72 Chain A

Receptor sequence
>1b72A (length=68) Species: 9606 (Homo sapiens) [Search protein sequence]
ARTFDWMKVLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQ
VKIWFQNRRMKQKKRERE
3D structure
PDB1b72 Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
ChainA
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R207 T208 F210 N253 R11 T12 F14 N57
BS02 dna A Y227 R233 Q252 R255 M256 K259 Y31 R37 Q56 R59 M60 K63
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1b72, PDBe:1b72, PDBj:1b72
PDBsum1b72
PubMed10052460
UniProtP14653|HXB1_HUMAN Homeobox protein Hox-B1 (Gene Name=HOXB1)

[Back to BioLiP]