Structure of PDB 1b5m Chain A

Receptor sequence

>1b5mA (length=84) Species: 10116 (Rattus norvegicus)

AVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGA
DATESFEDVGHSPDAREMLKQYYIGDVHPNDLKP

3D structure

• PDB: 1b5m 13C NMR spectroscopic and X-ray crystallographic study of the role played by mitochondrial cytochrome b5 heme propionates in the electrostatic binding to cytochrome c.
• Chain: A
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H39 G62
• Catalytic site (residue number reindexed from 1): H37 G60

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	M23 F35 H39 P40 G41 V45 L46 F58 V61 H63 S64 A67 L71	M21 F33 H37 P38 G39 V43 L44 F56 V59 H61 S62 A65 L69

Gene Ontology

Molecular Function

• GO:0020037 heme binding

External links

• PDB: RCSB:1b5m, PDBe:1b5m, PDBj:1b5m
• PDBsum: 1b5m
• PubMed: 8973214
• UniProt: P04166|CYB5B_RAT Cytochrome b5 type B (Gene Name=Cyb5b)