Structure of PDB 1b5a Chain A |
>1b5aA (length=94) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
DKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQA GGDATENFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSETL |
|
PDB | 1b5a The origin of differences in the physical properties of the equilibrium forms of cytochrome b5 revealed through high-resolution NMR structures and backbone dynamic analyses. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H39 G62 |
Catalytic site (residue number reindexed from 1) |
H39 G62 |
Enzyme Commision number |
? |
|
|
|
|