Structure of PDB 1b3t Chain A

Receptor sequence
>1b3tA (length=147) Species: 10376 (human gammaherpesvirus 4) [Search protein sequence]
KGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVY
GGSKTSLYNLRRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVC
YFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLP
3D structure
PDB1b3t The 2.2 A structure of a permanganate-sensitive DNA site bound by the Epstein-Barr virus origin binding protein, EBNA1.
ChainA
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.21.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K461 W464 F465 K467 R469 G470 G472 K514 Y518 R521 R522 P535 L536 R538 K1 W4 F5 K7 R9 G10 G12 K54 Y58 R61 R62 P75 L76 R78
BS02 dna A K461 G462 G463 W464 H468 R469 K477 S513 T515 N519 T590 K1 G2 G3 W4 H8 R9 K17 S53 T55 N59 T130
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1b3t, PDBe:1b3t, PDBj:1b3t
PDBsum1b3t
PubMed9878348
UniProtP03211|EBNA1_EBVB9 Epstein-Barr nuclear antigen 1 (Gene Name=EBNA1)

[Back to BioLiP]