Structure of PDB 1b3i Chain A |
>1b3iA (length=97) Species: 1223 (Prochlorothrix hollandica) [Search protein sequence] |
ASVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGE SAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE |
|
PDB | 1b3i NMR solution structure of plastocyanin from the photosynthetic prokaryote, Prochlorothrix hollandica. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
H39 C82 H85 M90 |
H39 C82 H85 M90 |
|
|
|
|